Structure of PDB 1k2d Chain B Binding Site BS01

Receptor Information

>1k2d Chain B (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELG
RPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSR
TEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTF
QVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA

Ligand information

>1k2d Chain P (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SRGGASQYRPSQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1k2d Structural snapshot of aberrant antigen presentation linked to autoimmunity: the immunodominant epitope of MBP complexed with I-Au
Resolution	2.2 Å
Binding residue (original residue number in PDB)	F11 Y26 Y30 D57 Y60 Y61 Y67 T71 E74 V78 Y81 N82
Binding residue (residue number reindexed from 1)	F7 Y22 Y26 D53 Y56 Y57 Y61 T65 E68 V72 Y75 N76

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1k2d, PDBe:1k2d, PDBj:1k2d
PDBsum	1k2d
PubMed	12150894
UniProt	P06344\|HB2U_MOUSE H-2 class II histocompatibility antigen, A-U beta chain

[Back to BioLiP]