Structure of PDB 1jyq Chain B Binding Site BS01

Receptor Information
>1jyq Chain B (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDV
QHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jyq Crystal structures of the SH2 domain of Grb2: highlight on the binding of a new high-affinity inhibitor.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R67 R86 S88 S90 S96 F101 Q106 H107 F108 K109 L120 W121 S141 R142 N143
Binding residue
(residue number reindexed from 1)		R12 R31 S33 S35 S41 F46 Q51 H52 F53 K54 L65 W66 S86 R87 N88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1jyq, PDBe:1jyq, PDBj:1jyq
PDBsum1jyq
PubMed11827484
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]