Structure of PDB 1jwu Chain B Binding Site BS01

Receptor Information
>1jwu Chain B (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVT
VYPSKTQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDW
TFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jwu Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L11 F13 Y47 P56 D57 Y60 W61 L67 Q70 R71 Y78 H81 N82 V85 F89
Binding residue
(residue number reindexed from 1)		L11 F13 Y47 P56 D57 Y60 W61 L67 Q70 R71 Y78 H81 N82 V85 F89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jwu, PDBe:1jwu, PDBj:1jwu
PDBsum1jwu
PubMed12962633
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]