Structure of PDB 1jt0 Chain B Binding Site BS01

Receptor Information

>1jt0 Chain B (length=188) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFL
EILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIE
FYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKI
AANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH

Ligand information

>1jt0 Chain E (length=28) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cttatagaccgatcgatcggtctataag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jt0 Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	T24 T25 K36 Y40 T45 K46
Binding residue (residue number reindexed from 1)	T23 T24 K35 Y39 T44 K45
Binding affinity	PDBbind-CN: Kd=49nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0045892	negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1jt0, PDBe:1jt0, PDBj:1jt0
PDBsum	1jt0
PubMed	11867549
UniProt	P0A0N4\|QACR_STAAU HTH-type transcriptional regulator QacR (Gene Name=qacR)

[Back to BioLiP]