Structure of PDB 1jsp Chain B Binding Site BS01

Receptor Information
>1jsp Chain B (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYF
DIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYK
FCSKLAEVFEQEIDPVMQSLG
Ligand information
>1jsp Chain A (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SHLKSKKGQSTSRHKKLMFK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jsp Structural mechanism of the bromodomain of the coactivator CBP in p53 transcriptional activation.
ResolutionN/A
Binding residue
(original residue number in PDB)		V1115 I1122 Y1167 N1168 R1169 S1172 R1173 V1174
Binding residue
(residue number reindexed from 1)		V39 I46 Y91 N92 R93 S96 R97 V98
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jsp, PDBe:1jsp, PDBj:1jsp
PDBsum1jsp
PubMed14759370
UniProtQ92793|CBP_HUMAN CREB-binding protein (Gene Name=CREBBP)

[Back to BioLiP]