Structure of PDB 1jpl Chain B Binding Site BS01

Receptor Information

>1jpl Chain B (length=159) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAV
RLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVV
SPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSD
PPIPVDRTL

Ligand information

>1jpl Chain F (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SDEDLLHI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jpl Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	K86 F87 R88 N91 I94 S98 K100 Y101 K130 M137
Binding residue (residue number reindexed from 1)	K89 F90 R91 N94 I97 S101 K103 Y104 K133 M140

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0031267	small GTPase binding
GO:0035091	phosphatidylinositol binding
GO:0043130	ubiquitin binding

	Biological Process
GO:0006886	intracellular protein transport

	Cellular Component
GO:0005802	trans-Golgi network

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1jpl, PDBe:1jpl, PDBj:1jpl
PDBsum	1jpl
PubMed	11859375
UniProt	Q9NZ52\|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 (Gene Name=GGA3)

[Back to BioLiP]