Structure of PDB 1jn5 Chain B Binding Site BS01

Receptor Information
>1jn5 Chain B (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLS
IPFIARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQ
HDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPAS
NSGLCIVNDELFVRNASSEEIQRAFAMPAPTP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jn5 Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Q486 T487 S488 L490 L491 A519 V520 P521
Binding residue
(residue number reindexed from 1)		Q113 T114 S115 L117 L118 A146 V147 P148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jn5, PDBe:1jn5, PDBj:1jn5
PDBsum1jn5
PubMed11583626
UniProtQ9UBU9|NXF1_HUMAN Nuclear RNA export factor 1 (Gene Name=NXF1)

[Back to BioLiP]