Structure of PDB 1jl4 Chain B Binding Site BS01

Receptor Information

>1jl4 Chain B (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSFVHQFQPFCYFTNGTQRIRLVIRYIYNREEYVRFDSDVGEYRAVTELG
RPDAEYWNKQYLERTRAELDTVCRHNYEKTETPTSLRRLEQPSVVISLSR
TEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTF
QVLVMLEMTPRRGEVYTCHVEHPSLTSPITVEWRA

Ligand information

>1jl4 Chain C (length=16) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GNSHRGAIEWEGIESG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jl4 Crystal structure of the human CD4 N-terminal two-domain fragment complexed to a class II MHC molecule.
Resolution	4.3 Å
Binding residue (original residue number in PDB)	F11 Y30 Y47 P56 D57 Y60 W61 Y67 R70 E74 V78 N82 T85
Binding residue (residue number reindexed from 1)	F7 Y26 Y43 P52 D53 Y56 W57 Y61 R64 E68 V72 N76 T80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1jl4, PDBe:1jl4, PDBj:1jl4
PDBsum	1jl4
PubMed	11535811
UniProt	P06343\|HB2K_MOUSE H-2 class II histocompatibility antigen, A-K beta chain (Gene Name=H2-Ab1)

[Back to BioLiP]