Structure of PDB 1jj4 Chain B Binding Site BS01

Receptor Information
>1jj4 Chain B (length=76) Species: 333761 (human papillomavirus 18) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTEKTGILTVTYH
SETQRTKFLNTVAIPDSVQILVGYMT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jj4 The structural basis of DNA target discrimination by papillomavirus E2 proteins.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
N297 S298 C301 R305 S355
Binding residue
(residue number reindexed from 1)
N13 S14 C17 R21 S67
Binding affinityPDBbind-CN: Kd=1.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1jj4, PDBe:1jj4, PDBj:1jj4
PDBsum1jj4
PubMed10906136
UniProtP06790|VE2_HPV18 Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]