Structure of PDB 1jgg Chain B Binding Site BS01

Receptor Information
>1jgg Chain B (length=57) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNR
RMKDKRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jgg Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R303 Y304 R305 T306 V347 Q350 N351
Binding residue
(residue number reindexed from 1)		R1 Y2 R3 T4 V45 Q48 N49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jgg, PDBe:1jgg, PDBj:1jgg
PDBsum1jgg
PubMed8557047
UniProtP06602|EVE_DROME Segmentation protein even-skipped (Gene Name=eve)

[Back to BioLiP]