Structure of PDB 1jfi Chain B Binding Site BS01

Receptor Information

DDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEIC
NKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRL
ENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQ

Ligand information

ttggctataaaagggctc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	1jfi Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
Resolution	2.62 Å
Binding residue (original residue number in PDB)	K164 R202
Binding residue (residue number reindexed from 1)	K56 R94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0017025	TBP-class protein binding
GO:0046982	protein heterodimerization activity
GO:0140223	general transcription initiation factor activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0045995	regulation of embryonic development
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0051302	regulation of cell division
GO:0051726	regulation of cell cycle
GO:0090043	regulation of tubulin deacetylation

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0017054	negative cofactor 2 complex
GO:0072686	mitotic spindle
GO:0090575	RNA polymerase II transcription regulator complex
GO:0140672	ATAC complex

External links

PDB	RCSB:1jfi, PDBe:1jfi, PDBj:1jfi
PDBsum	1jfi
PubMed	11461703
UniProt	Q01658\|NC2B_HUMAN Protein Dr1 (Gene Name=DR1)