Structure of PDB 1jb7 Chain B Binding Site BS01

Receptor Information
>1jb7 Chain B (length=216) Species: 200597 (Sterkiella nova) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYFF
VAPYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFTS
YANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQA
AINKTVKGDNLVDISKVADAAGKKGKVDAGIVKASASKGDEFSDFSFKEG
NTATLKIADIFVQEKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jb7 DNA G-quartets in a 1.86 A resolution structure of an Oxytricha nova telomeric protein-DNA complex.
Resolution1.86 Å
Binding residue
(original residue number in PDB)		E45 H49 F106 Y109 Y134 R140 K145
Binding residue
(residue number reindexed from 1)		E37 H41 F98 Y101 Y126 R132 K137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
Cellular Component
GO:0000781 chromosome, telomeric region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1jb7, PDBe:1jb7, PDBj:1jb7
PDBsum1jb7
PubMed11428895
UniProtP16458|TEBB_STENO Telomere-binding protein subunit beta (Gene Name=MAC-41A)

[Back to BioLiP]