Structure of PDB 1j8h Chain B Binding Site BS01

Receptor Information
>1j8h Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTE
LGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVY
PANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVM
LETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j8h Structure of a complex of the human alpha/beta T cell receptor (TCR) HA1.7, influenza hemagglutinin peptide, and major histocompatibility complex class II molecule, HLA-DR4 (DRA*0101 and DRB1*0401): insight into TCR cross-restriction and alloreactivity.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		H13 F26 Y30 Y47 D57 Y60 W61 Q70 K71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		H11 F24 Y28 Y45 D55 Y58 W59 Q68 K69 Y76 H79 N80 V83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1j8h, PDBe:1j8h, PDBj:1j8h
PDBsum1j8h
PubMed11877480
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]