Structure of PDB 1j6t Chain B Binding Site BS01

Receptor Information

>1j6t Chain B (length=85) Species: 562 (Escherichia coli)

MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKL
QTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE

Ligand information

• Ligand ID: PO3
• InChI: InChI=1S/O3P/c1-4(2)3/q-3
• InChIKey: AQSJGOWTSHOLKH-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [O-][P-]([O-])=O
  ACDLabs 10.04: [O-][PH2-]([O-])=O
  OpenEye OEToolkits 1.5.0: [O-][P-](=O)[O-]
• Formula: O3 P
• Name: PHOSPHITE ION
• PDB chain: 1j6t Chain B Residue 200

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1j6t Solution Structure of the Phosphoryl Transfer Complex between the Cytoplasmic A Domain of the Mannitol Transporter IImannitol and HPr of the Escherichia coli Phosphotransferase System
• Resolution: N/A
• Binding residue (original residue number in PDB): H315 T316
• Binding residue (residue number reindexed from 1): H15 T16
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0004857 enzyme inhibitor activity
• GO:0005515 protein binding
• GO:0008047 enzyme activator activity
• GO:0016775 phosphotransferase activity, nitrogenous group as acceptor
• GO:0030234 enzyme regulator activity
• GO:0045152 antisigma factor binding

Biological Process

• GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system
• GO:0043609 regulation of carbon utilization
• GO:0045819 positive regulation of glycogen catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1j6t, PDBe:1j6t, PDBj:1j6t
• PDBsum: 1j6t
• PubMed: 12202490
• UniProt: P0AA04|PTHP_ECOLI Phosphocarrier protein HPr (Gene Name=ptsH)