Structure of PDB 1is0 Chain B Binding Site BS01

Receptor Information

>1is0 Chain B (length=102) Species: 11886 (Rous sarcoma virus)

EEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAK
GLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVC
PT

Ligand information

>1is0 Chain D (length=4)

uEEI

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1is0 Calorimetric and structural studies of 1,2,3-trisubstituted cyclopropanes as conformationally constrained peptide inhibitors of Src SH2 domain binding.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): R155 R175 S177 E178 T179 C185 K200 H201 Y202 K203 R205 T215
• Binding residue (residue number reindexed from 1): R10 R30 S32 E33 T34 C40 K55 H56 Y57 K58 R60 T70

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:1is0, PDBe:1is0, PDBj:1is0
• PDBsum: 1is0
• PubMed: 11782172
• UniProt: P00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)