Structure of PDB 1ik9 Chain B Binding Site BS01

Receptor Information
>1ik9 Chain B (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSES
EISQEADDMAMEKGKYVGELRKALLSVYTFNFSKESAYFFFEKNLKDVSF
RLGSFNLEKVENPAEVIRELIAYALDTIAENQAKNEHLQKENERLLRDWN
DVQGRFEKAVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNA
Ligand information
>1ik9 Chain C (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AREYDCYGDSYFIDTDLNQLKEVFSGIK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ik9 Crystal structure of an Xrcc4-DNA ligase IV complex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R179 F180 L182 V183 E186 K187 K190
Binding residue
(residue number reindexed from 1)		R173 F174 L176 V177 E180 K181 K184
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ik9, PDBe:1ik9, PDBj:1ik9
PDBsum1ik9
PubMed11702069
UniProtQ13426|XRCC4_HUMAN DNA repair protein XRCC4 (Gene Name=XRCC4)

[Back to BioLiP]