Structure of PDB 1ign Chain B Binding Site BS01

Receptor Information
>1ign Chain B (length=189) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRV
YLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAI
AVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENA
WRDRFRKFLLAYGIDDYISYYEAEEPMKNLTPTPGNYNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ign The crystal structure of the DNA-binding domain of yeast RAP1 in complex with telomeric DNA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		K360 A361 S362 F363 H398 T399 N401 S402 H405 R406 Y410 K446 R447 F449 H536 T537 N539 A540 D543 R544 F548 K575 N576 T578 T588 P589 G590 N591 N593 S594
Binding residue
(residue number reindexed from 1)		K1 A2 S3 F4 H39 T40 N42 S43 H46 R47 Y51 K87 R88 F90 H146 T147 N149 A150 D153 R154 F158 K178 N179 T181 T183 P184 G185 N186 N188 S189
Binding affinityPDBbind-CN: Kd=13pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ign, PDBe:1ign, PDBj:1ign
PDBsum1ign
PubMed8620531
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]