Structure of PDB 1ice Chain B Binding Site BS01

Receptor Information
>1ice Chain B (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDV
EEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ice Structure and mechanism of interleukin-1 beta converting enzyme.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		V338 S339 W340 R341 H342
Binding residue
(residue number reindexed from 1)		V22 S23 W24 R25 H26
Enzymatic activity
Enzyme Commision number 3.4.22.36: caspase-1.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ice, PDBe:1ice, PDBj:1ice
PDBsum1ice
PubMed8035875
UniProtP29466|CASP1_HUMAN Caspase-1 (Gene Name=CASP1)

[Back to BioLiP]