Structure of PDB 1ic8 Chain B Binding Site BS01

Receptor Information
>1ic8 Chain B (length=173) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVV
DTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHRNRFK
WGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLG
SNLVTEVRVYNWFANRRKEEAFR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ic8 Diabetes mutations delineate an atypical POU domains in HNF1-Alpha
Resolution2.6 Å
Binding residue
(original residue number in PDB)		N140 S142 H143 P153 M154 K155 K158 R203 F204 K205 W206 R263 N270
Binding residue
(residue number reindexed from 1)		N56 S58 H59 P69 M70 K71 K74 R98 F99 K100 W101 R158 N165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0001889 liver development
GO:0006357 regulation of transcription by RNA polymerase II
GO:0030073 insulin secretion
GO:0031016 pancreas development
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ic8, PDBe:1ic8, PDBj:1ic8
PDBsum1ic8
PubMed12453420
UniProtP20823|HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha (Gene Name=HNF1A)

[Back to BioLiP]