Structure of PDB 1ibc Chain B Binding Site BS01

Receptor Information
>1ibc Chain B (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDV
EEIFRKVRFSFEQPAGRAQMPTTERVTLTRCFYLFPGH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ibc A combinatorial approach for determining protease specificities: application to interleukin-1beta converting enzyme (ICE).
Resolution2.73 Å
Binding residue
(original residue number in PDB)		S339 W340 R341 H342 V348 R383
Binding residue
(residue number reindexed from 1)		S23 W24 R25 H26 V32 R67
Enzymatic activity
Catalytic site (original residue number in PDB) E390
Catalytic site (residue number reindexed from 1) E74
Enzyme Commision number 3.4.22.36: caspase-1.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ibc, PDBe:1ibc, PDBj:1ibc
PDBsum1ibc
PubMed9190289
UniProtP29466|CASP1_HUMAN Caspase-1 (Gene Name=CASP1)

[Back to BioLiP]