Structure of PDB 1iak Chain B Binding Site BS01

Receptor Information
>1iak Chain B (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFVHQFQPFCYFTNGTQRIRLVIRYIYNREEYVRFDSDVGEYRAVTELG
RPDAEYWNKQYLERTRAELDTVCRHNYEKTETPTSLRRLEQPSVVISLSR
TEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTF
QVLVMLEMTPRRGEVYTCHVEHPSLTSPITVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1iak Crystal structure of I-Ak in complex with a dominant epitope of lysozyme.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		H9 F11 P13 Y30 Y47 D57 Y60 W61 Y67 E74 V78 H81 N82 K84A T85
Binding residue
(residue number reindexed from 1)		H5 F7 P9 Y26 Y43 D53 Y56 W57 Y61 E68 V72 H75 N76 K79 T80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1iak, PDBe:1iak, PDBj:1iak
PDBsum1iak
PubMed9529148
UniProtP06343|HB2K_MOUSE H-2 class II histocompatibility antigen, A-K beta chain (Gene Name=H2-Ab1)

[Back to BioLiP]