Structure of PDB 1i8i Chain B Binding Site BS01

Receptor Information
>1i8i Chain B (length=119) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVKLQQSGGGLVKPGASLKLSCVTSGFTFRKFGMSWVRQTSDKCLEWVAS
ISTGGYNTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCTRGY
SSTSYAMDYWGQGTTVTVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i8i Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S352 T353 G354 Y356 N357 Y359 S402 T403 S404 Y405
Binding residue
(residue number reindexed from 1)		S52 T53 G54 Y56 N57 Y59 S102 T103 S104 Y105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0016064 immunoglobulin mediated immune response
Cellular Component
GO:0019814 immunoglobulin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i8i, PDBe:1i8i, PDBj:1i8i
PDBsum1i8i
PubMed11352579
UniProtP18529|HVM58_MOUSE Ig heavy chain V region 5-76

[Back to BioLiP]