Structure of PDB 1i7a Chain B Binding Site BS01

Receptor Information
>1i7a Chain B (length=103) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQPIFTTRAHVFQINWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIIN
STITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEVRE
AAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i7a The N-terminal domain of Homer/Vesl is a new class II EVH1 domain.
Resolution2.24 Å
Binding residue
(original residue number in PDB)		S71 K73 F74
Binding residue
(residue number reindexed from 1)		S63 K65 F66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035256 G protein-coupled glutamate receptor binding
Biological Process
GO:0007216 G protein-coupled glutamate receptor signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1i7a, PDBe:1i7a, PDBj:1i7a
PDBsum1i7a
PubMed11491285
UniProtQ9QWW1|HOME2_MOUSE Homer protein homolog 2 (Gene Name=Homer2)

[Back to BioLiP]