Structure of PDB 1i6u Chain B Binding Site BS01

Receptor Information
>1i6u Chain B (length=127) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDPLANALNHISNCERVGKKVVYIKPASKLIGRVLKVMQDNGYIGEFEFI
EDGRAGIFKVELIGKINKCGAIKPRFPVKKFGYEKFEKRYLPARDFGILI
VSTTQGVMSHEEAKKRGLGGRLLAYVY
Ligand information
>1i6u Chain C (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcccgguaagucucuucggagauacugccgggccc
<<<<<<<<<.<<<<<<....>>>>..>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i6u Detailed analysis of RNA-protein interactions within the ribosomal protein S8-rRNA complex from the archaeon Methanococcus jannaschii.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		F84 E87 K118
Binding residue
(residue number reindexed from 1)		F81 E84 K115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i6u, PDBe:1i6u, PDBj:1i6u
PDBsum1i6u
PubMed11478863
UniProtP54041|RS8_METJA Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]