Structure of PDB 1hy2 Chain B Binding Site BS01

Receptor Information
>1hy2 Chain B (length=123) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hy2 Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-Protein Complexes
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y54 W79 R84 T90 W108
Binding residue
(residue number reindexed from 1)		Y42 W67 R72 T78 W96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1hy2, PDBe:1hy2, PDBj:1hy2
PDBsum1hy2
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]