Structure of PDB 1hxz Chain B Binding Site BS01

Receptor Information
>1hxz Chain B (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hxz Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-Protein Complexes
Resolution1.8 Å
Binding residue
(original residue number in PDB)		L25 S45 Y54 W79 R84 T90 W108
Binding residue
(residue number reindexed from 1)		L13 S33 Y42 W67 R72 T78 W96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1hxz, PDBe:1hxz, PDBj:1hxz
PDBsum1hxz
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]