Structure of PDB 1hxy Chain B Binding Site BS01

Receptor Information
>1hxy Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTE
LGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVY
PHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVM
LETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
>1hxy Chain C (length=13) Species: 385585 (Influenza A virus (A/equine/Jilin/1/1989(H3N8))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hxy Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L11 F13 Y47 D57 Y60 W61 Q70 R71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		L9 F11 Y45 D55 Y58 W59 Q68 R69 Y76 H79 N80 V83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hxy, PDBe:1hxy, PDBj:1hxy
PDBsum1hxy
PubMed11432818
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]