Structure of PDB 1hxl Chain B Binding Site BS01

Receptor Information

>1hxl Chain B (length=119) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVK

Ligand information

>1hxl Chain D (length=13) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RCCHPQCGMAEEC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1hxl Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-Protein Complexes
Resolution	1.8 Å
Binding residue (original residue number in PDB)	Y54 W79 R84 T90 W108
Binding residue (residue number reindexed from 1)	Y39 W64 R69 T75 W93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:1hxl, PDBe:1hxl, PDBj:1hxl
PDBsum	1hxl
PubMed
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]