Structure of PDB 1htm Chain B Binding Site BS01

Receptor Information
>1htm Chain B (length=114) Species: 140147 (uncultured beta proteobacterium UMTRA-608) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKI
DLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFK
IYHKCDNACIESIR
Ligand information
>1htm Chain A (length=5) Species: 140147 (uncultured beta proteobacterium UMTRA-608) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TLCLG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1htm Structure of influenza haemagglutinin at the pH of membrane fusion.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S93 E97 R123 L126 G136 C137 F138
Binding residue
(residue number reindexed from 1)		S54 E58 R84 L87 G97 C98 F99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046789 host cell surface receptor binding
Biological Process
GO:0019064 fusion of virus membrane with host plasma membrane
Cellular Component
GO:0019031 viral envelope

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1htm, PDBe:1htm, PDBj:1htm
PDBsum1htm
PubMed8072525
UniProtP03437|HEMA_I68A0 Hemagglutinin (Gene Name=HA)

[Back to BioLiP]