Structure of PDB 1hlz Chain B Binding Site BS01

Receptor Information
>1hlz Chain B (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCS
IVRINRNRCQQCRFKKCLSVGMSRDAVRFGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hlz DNA Deformability as a Recognition Feature in the RevErb Response Element
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G10 F11 H12 Y13 K22 R26 V71 F73 R75
Binding residue
(residue number reindexed from 1)		G15 F16 H17 Y18 K27 R31 V77 F79 R81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hlz, PDBe:1hlz, PDBj:1hlz
PDBsum1hlz
PubMed11669620
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]