Structure of PDB 1hc9 Chain B Binding Site BS01

Receptor Information
>1hc9 Chain B (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPS
KKPYEEVTCCSTDKCNPHPKQRPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hc9 The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		T6 A7 T8 S9 I11 D30 R36 K38 V39 V40 H68 K70
Binding residue
(residue number reindexed from 1)		T6 A7 T8 S9 I11 D30 R36 K38 V39 V40 H68 K70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hc9, PDBe:1hc9, PDBj:1hc9
PDBsum1hc9
PubMed11683996
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]