Structure of PDB 1h9t Chain B Binding Site BS01

Receptor Information
>1h9t Chain B (length=226) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQR
LARDGWLTIQHGKPTKVNNFWETSGLNILETLARLDHESVPQLIDNLLSV
RTNISTIFIRTAFRQHPDKAQEVLATANEVADHADAFAELDYNIFRGLAF
ASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGA
HDQVYETVRRYGHESGEIWHRMQKNL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h9t The Structural Basis of Acyl Coenzyme A-Dependent Regulation of the Transcription Factor Fadr
Resolution3.25 Å
Binding residue
(original residue number in PDB)		A33 E34 R35 R45 R49 H65 G66
Binding residue
(residue number reindexed from 1)		A29 E30 R31 R41 R45 H61 G62
Binding affinityPDBbind-CN: Kd=0.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000062 fatty-acyl-CoA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006631 fatty acid metabolic process
GO:0019217 regulation of fatty acid metabolic process
GO:0045723 positive regulation of fatty acid biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h9t, PDBe:1h9t, PDBj:1h9t
PDBsum1h9t
PubMed11296236
UniProtP0A8V6|FADR_ECOLI Fatty acid metabolism regulator protein (Gene Name=fadR)

[Back to BioLiP]