Structure of PDB 1h2d Chain B Binding Site BS01

Receptor Information
>1h2d Chain B (length=123) Species: 205488 (Ebola virus sp.) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLA
SYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQL
PQYFTFDLTALKLITQPLPAATW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h2d The Matrix Protein Vp40 from Ebola Virus Octamerizes Into Pore-Like Structures with Specific RNA Binding Properties
Resolution2.6 Å
Binding residue
(original residue number in PDB)
F125 G126 R134 Y171
Binding residue
(residue number reindexed from 1)
F57 G58 R66 Y103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1h2d, PDBe:1h2d, PDBj:1h2d
PDBsum1h2d
PubMed12679020
UniProtQ05128|VP40_EBOZM Matrix protein VP40 (Gene Name=VP40)

[Back to BioLiP]