Structure of PDB 1gzl Chain B Binding Site BS01

Receptor Information
>1gzl Chain B (length=45) Species: 11706,559292 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Ligand information
>1gzl Chain D (length=12) Species: 12721 (Human immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WEEWDREIENYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gzl Short Constrained Peptides that Inhibit HIV-1 Entry
Resolution1.8 Å
Binding residue
(original residue number in PDB)
R25 K28 L29 L32 W35 G36 Q39 R43
Binding residue
(residue number reindexed from 1)
R25 K28 L29 L32 W35 G36 Q39 R43
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1gzl, PDBe:1gzl, PDBj:1gzl
PDBsum1gzl
PubMed12417739
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4);
P04578|ENV_HV1H2 Envelope glycoprotein gp160 (Gene Name=env)

[Back to BioLiP]