Structure of PDB 1gyb Chain B Binding Site BS01

Receptor Information
>1gyb Chain B (length=122) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVE
KLVSLPFQKVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQV
FHLIPDGNSYYVFNDIFRLNYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gyb Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats
Resolution1.9 Å
Binding residue
(original residue number in PDB)		M36 Q43 Q45
Binding residue
(residue number reindexed from 1)		M34 Q41 Q43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031267 small GTPase binding
GO:0061608 nuclear import signal receptor activity
Biological Process
GO:0006606 protein import into nucleus
GO:0006913 nucleocytoplasmic transport
GO:0015031 protein transport
Cellular Component
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0044613 nuclear pore central transport channel

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1gyb, PDBe:1gyb, PDBj:1gyb
PDBsum1gyb
PubMed12065398
UniProtP33331|NTF2_YEAST Nuclear transport factor 2 (Gene Name=NTF2)

[Back to BioLiP]