Structure of PDB 1gxp Chain B Binding Site BS01

Receptor Information
>1gxp Chain B (length=101) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQ
LLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTR
F
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gxp Tandem DNA Recognition by Two-Component Signal Transduction Transcriptional Activator Phob
Resolution2.5 Å
Binding residue
(original residue number in PDB)		P157 T158 Y189 V190 E191 T194 V197 H198 R201
Binding residue
(residue number reindexed from 1)		P29 T30 Y61 V62 E63 T66 V69 H70 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gxp, PDBe:1gxp, PDBj:1gxp
PDBsum1gxp
PubMed12015152
UniProtP0AFJ5|PHOB_ECOLI Phosphate regulon transcriptional regulatory protein PhoB (Gene Name=phoB)

[Back to BioLiP]