Structure of PDB 1gux Chain B Binding Site BS01

Receptor Information
>1gux Chain B (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYEL
MRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLI
KEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gux Structure of the retinoblastoma tumour-suppressor pocket domain bound to a peptide from HPV E7.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y709 K713 K720 F721 K722 I753 Y756 N757 M761
Binding residue
(residue number reindexed from 1)		Y65 K69 K76 F77 K78 I109 Y112 N113 M117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1gux, PDBe:1gux, PDBj:1gux
PDBsum1gux
PubMed9495340
UniProtP06400|RB_HUMAN Retinoblastoma-associated protein (Gene Name=RB1)

[Back to BioLiP]