Structure of PDB 1glu Chain B Binding Site BS01

Receptor Information
>1glu Chain B (length=81) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPARPCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRYRKCLQAGMNLEARKTKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1glu Crystallographic analysis of the interaction of the glucocorticoid receptor with DNA.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		G449 C450 H451 Y452 K461 K465 R510
Binding residue
(residue number reindexed from 1)		G16 C17 H18 Y19 K28 K32 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1glu, PDBe:1glu, PDBj:1glu
PDBsum1glu
PubMed1865905
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]