Structure of PDB 1g9z Chain B Binding Site BS01

Receptor Information
>1g9z Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g9z The homing endonuclease I-CreI uses three metals, one of which is shared between the two active sites.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
S232 Y233 K234 Q238 R268 R270 E280 I281 K316 D337 K339
Binding residue
(residue number reindexed from 1)
S31 Y32 K33 Q37 R67 R69 E79 I80 K115 D136 K138
Enzymatic activity
Catalytic site (original residue number in PDB) G219 D220
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1g9z, PDBe:1g9z, PDBj:1g9z
PDBsum1g9z
PubMed11276249
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]