Structure of PDB 1g9y Chain B Binding Site BS01

Receptor Information
>1g9y Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g9y The homing endonuclease I-CreI uses three metals, one of which is shared between the two active sites.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		D220 G221 S222 I224 Q226 K228 Q244 T246 Q247 K248 R270 V273 A333 N336 D337 S338 R341 K342 T343
Binding residue
(residue number reindexed from 1)		D19 G20 S21 I23 Q25 K27 Q43 T45 Q46 K47 R69 V72 A132 N135 D136 S137 R140 K141 T142
Enzymatic activity
Catalytic site (original residue number in PDB) G219 D220
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g9y, PDBe:1g9y, PDBj:1g9y
PDBsum1g9y
PubMed11276249
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]