Structure of PDB 1g7a Chain B Binding Site BS01

Receptor Information
>1g7a Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1g7a Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g7a Phase changes in T(3)R(3)(f) human insulin: temperature or pressure induced?
Resolution1.2 Å
Binding residue
(original residue number in PDB)
N3 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 T30
Binding residue
(residue number reindexed from 1)
N3 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1g7a, PDBe:1g7a, PDBj:1g7a
PDBsum1g7a
PubMed11468392
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]