Structure of PDB 1g6g Chain B Binding Site BS01

Receptor Information
>1g6g Chain B (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNI
SRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEIT
VGVGVESDILSLVIFINDKFKQCL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g6g The molecular basis of FHA domain:phosphopeptide binding specificity and implications for phospho-dependent signaling mechanisms.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
R70 S82 R83 S85 N86 T106 N107 W110
Binding residue
(residue number reindexed from 1)
R39 S51 R52 S54 N55 T75 N76 W79
Enzymatic activity
Enzyme Commision number 2.7.12.1: dual-specificity kinase.
External links
PDB RCSB:1g6g, PDBe:1g6g, PDBj:1g6g
PDBsum1g6g
PubMed11106755
UniProtP22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 (Gene Name=RAD53)

[Back to BioLiP]