Structure of PDB 1g1e Chain B Binding Site BS01

Receptor Information

>1g1e Chain B (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKE
AGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA

Ligand information

>1g1e Chain A (length=16) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RMNIQMLLEAADYLER

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1g1e Solution structure of the interacting domains of the Mad-Sin3 complex: implications for recruitment of a chromatin-modifying complex.
Resolution	N/A
Binding residue (original residue number in PDB)	E303 F304 A307 I308 V311 K315 Y325 L329 L332 H333 Y335 Q336
Binding residue (residue number reindexed from 1)	E9 F10 A13 I14 V17 K21 Y31 L35 L38 H39 Y41 Q42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003714	transcription corepressor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1g1e, PDBe:1g1e, PDBj:1g1e
PDBsum	1g1e
PubMed	11106735
UniProt	Q60520\|SIN3A_MOUSE Paired amphipathic helix protein Sin3a (Gene Name=Sin3a)

[Back to BioLiP]