Structure of PDB 1fyr Chain B Binding Site BS01

Receptor Information
>1fyr Chain B (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGND
VQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fyr Dimer formation through domain swapping in the crystal structure of the Grb2-SH2-Ac-pYVNV complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
R67 R86 S88 S90 S96 Q106 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)
R13 R32 S34 S36 S42 Q52 H53 F54 K55 L66 W67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1fyr, PDBe:1fyr, PDBj:1fyr
PDBsum1fyr
PubMed11063574
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]