Structure of PDB 1fev Chain B Binding Site BS01

Receptor Information
>1fev Chain B (length=101) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCY
QSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDAS
V
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fev Structural and thermodynamic consequences of introducing alpha-aminoisobutyric acid in the S peptide of ribonuclease S.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		Y25 R33 L35 N44 T45 F46 V47 H48 E49 L51 P117 H119
Binding residue
(residue number reindexed from 1)		Y2 R10 L12 N21 T22 F23 V24 H25 E26 L28 P94 H96
Enzymatic activity
Catalytic site (original residue number in PDB) K41 H119 F120 D121
Catalytic site (residue number reindexed from 1) K18 H96 F97 D98
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:1fev, PDBe:1fev, PDBj:1fev
PDBsum1fev
PubMed11112508
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]