Structure of PDB 1fa5 Chain B Binding Site BS01

Receptor Information

>1fa5 Chain B (length=128) Species: 562 (Escherichia coli)

MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPET
EEAVIELTYNWGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREA
GPVKGGTTVIAFVEDPDGYKIELIEEGN

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1fa5 Chain A Residue 1200

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1fa5 Determination of the structure of Escherichia coli glyoxalase I suggests a structural basis for differential metal activation.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): H74 E122
• Binding residue (residue number reindexed from 1): H74 E122
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): H5 E56 H74 E122
• Catalytic site (residue number reindexed from 1): H5 E56 H74 E122
• Enzyme Commision number: 4.4.1.5: lactoylglutathione lyase.

Gene Ontology

Molecular Function

• GO:0004462 lactoylglutathione lyase activity
• GO:0005515 protein binding
• GO:0016151 nickel cation binding
• GO:0016829 lyase activity
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009636 response to toxic substance
• GO:0019243 methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1fa5, PDBe:1fa5, PDBj:1fa5
• PDBsum: 1fa5
• PubMed: 10913283
• UniProt: P0AC81|LGUL_ECOLI Lactoylglutathione lyase (Gene Name=gloA)