Structure of PDB 1f4k Chain B Binding Site BS01

Receptor Information
>1f4k Chain B (length=115) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEV
YRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVEL
DRSKKLIEKALSDNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f4k Structure of the RTP-DNA complex and the mechanism of polar replication fork arrest
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T9 Y33 G34 L35 H54 Y58 H62 Q72 V85
Binding residue
(residue number reindexed from 1)		T2 Y26 G27 L28 H47 Y51 H55 Q65 V78
Binding affinityPDBbind-CN: Kd=20pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006274 DNA replication termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f4k, PDBe:1f4k, PDBj:1f4k
PDBsum1f4k
PubMed11224562
UniProtP0CI76|RTP_BACSU Replication termination protein (Gene Name=rtp)

[Back to BioLiP]