Structure of PDB 1f47 Chain B Binding Site BS01

Receptor Information
>1f47 Chain B (length=144) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLS
PDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQLFKL
MLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA
Ligand information
>1f47 Chain A (length=17) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KEPDYLDIPAFLRKQAD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f47 The bacterial cell-division protein ZipA and its interaction with an FtsZ fragment revealed by X-ray crystallography.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		M42 I44 M64 V65 K66 F85 Q87 R121
Binding residue
(residue number reindexed from 1)		M42 I44 M64 V65 K66 F85 Q87 R121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090529 cell septum assembly
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1f47, PDBe:1f47, PDBj:1f47
PDBsum1f47
PubMed10880432
UniProtP77173|ZIPA_ECOLI Cell division protein ZipA (Gene Name=zipA)

[Back to BioLiP]