Structure of PDB 1f3r Chain B Binding Site BS01

Receptor Information
>1f3r Chain B (length=257) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLLESGPGLVRPSETLSLTCTVSGFSLTSFSVSWVRHPSGKGPEWMGR
MWYDGYTAYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDLY
GGYPLGFWYFDFWGPGTMVTVSSGGGGSGGGGSGGGGSDIKLTQSPSLLS
ASVGDRVTLSCKGSQNINNYLAWYQQKLGEAPKLLIYNTNSLQTGIPSRF
SGSGSGTDYTLTISSLQPEDVATYFCYQYNNGYTFGAGTKLELKAAEQKL
ISEEDLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f3r The third-dimensional structure of the complex between an Fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor: a combined two-dimensional NMR, homology, and molecular modeling approach.
ResolutionN/A
Binding residue
(original residue number in PDB)		W47 R50 W52 Y56 A58 Y59 N60 S61 K64 P104 G106 F107 Y170 Y229 N230 N231 G232 Y233
Binding residue
(residue number reindexed from 1)		W47 R50 W52 Y56 A58 Y59 N60 S61 K64 P104 G106 F107 Y170 Y229 N230 N231 G232 Y233
External links