Structure of PDB 1eyx Chain B Binding Site BS01

Receptor Information

>1eyx Chain B (length=177) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLDAFSRVISNADAKAAYVGGSDLQALRTFISDGNKRLDAVNYIVSNSSC
IVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYISYALLAG
DSSVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAVGAFISNTASQRK
GEVIEGDCSALAAEIASYCDRISAAVS

Ligand information

>1eyx Chain G (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAFRAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1eyx Crystallization and 2.2 A resolution structure of R-phycoerythrin from Gracilaria chilensis: a case of perfect hemihedral twinning.
Resolution	2.25 Å
Binding residue (original residue number in PDB)	C109 G112 L113 T116
Binding residue (residue number reindexed from 1)	C109 G112 L113 T116

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1eyx, PDBe:1eyx, PDBj:1eyx
PDBsum	1eyx
PubMed	11134927
UniProt	Q7SIF9\|PHEB_AGACH R-phycoerythrin beta chain (Gene Name=rpeB)

[Back to BioLiP]